PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g011740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 489aa    MW: 54655.9 Da    PI: 7.5025
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g011740.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.93.7e-182731896
                    --HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3 18 lpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                    +p kf++eh  g+ + +   + l +  s ++W+vk+  ++++    lt+GWk+Fv+a++L++gDfvvF+++g++ f  +v++
  Csa11g011740.1  2 IPVKFFSEHivGKHEGR--SVNLVSdASEKTWKVKM--EGHR----LTDGWKQFVEAHDLRVGDFVVFRHEGDMLF--HVTA 73
                    9********86555444..5665554999*******..6666....***********************9998888..6665 PP

2B372.84.1e-23122216399
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +  ++ ++l+++ +++p +fa+++g++ke++ +++l++ +g+sWe  ++ +++  r  + +GW +F++an+L++gD+++F+l  ++ +++v+k++
  Csa11g011740.1 122 SLSVTDSNLSRDTVCVPINFARRYGLDKERQ-EIVLMNNEGKSWESVVKSWGGC-RLSIVRGWTSFCNANKLEVGDTCTFRLLPNTAETPVFKLC 214
                     55678999*******************9875.****************888885.788999*********************9999999*****9 PP

                     -S CS
              B3  98 rk 99 
                     ++
  Csa11g011740.1 215 SR 216
                     87 PP

3B345.21.6e-14239332195
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE..EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr..yvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                     f+k +++ ++l +g   lp +f++++ +++++  +++l d++  +W +kl+++k+ +   ++ ++GWk+F+ an++ +g++++++l++  ++ ++
  Csa11g011740.1 239 FVKLTLTRNSLHLGKQHLPVSFTRNNRLINPG--KIILVDKNRAEWPMKLNVDKSTRLmyIISGNGWKSFCAANEIGAGESLTLELIQ-GGKIPL 330
                     788999999999999***********999655..7***************887777666444569********************998.444455 PP

                     EE CS
              B3  94 vk 95 
                     +k
  Csa11g011740.1 331 LK 332
                     55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086314.677177IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.8E-21179IPR015300DNA-binding pseudobarrel domain
PfamPF023621.4E-12269IPR003340B3 DNA binding domain
SMARTSM010192.0E-12277IPR003340B3 DNA binding domain
CDDcd100178.23E-17272No hitNo description
SuperFamilySSF1019367.85E-19283IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.6E-21115214IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.53E-21116217IPR015300DNA-binding pseudobarrel domain
CDDcd100173.89E-19120210No hitNo description
PROSITE profilePS5086314.593120216IPR003340B3 DNA binding domain
PfamPF023623.3E-22121216IPR003340B3 DNA binding domain
SMARTSM010198.2E-25121217IPR003340B3 DNA binding domain
SuperFamilySSF1019362.94E-17236339IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-15237334IPR015300DNA-binding pseudobarrel domain
CDDcd100176.13E-16238326No hitNo description
PfamPF023627.6E-14239333IPR003340B3 DNA binding domain
SMARTSM010191.3E-25239337IPR003340B3 DNA binding domain
PROSITE profilePS5086312.887239336IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
NIPVKFFSEH IVGKHEGRSV NLVSDASEKT WKVKMEGHRL TDGWKQFVEA HDLRVGDFVV  60
FRHEGDMLFH VTALGSSCCE IQYAQPHCHE EDEEINETEI SSRSEKHVEE NVKTESDLNC  120
FSLSVTDSNL SRDTVCVPIN FARRYGLDKE RQEIVLMNNE GKSWESVVKS WGGCRLSIVR  180
GWTSFCNANK LEVGDTCTFR LLPNTAETPV FKLCSRIMSE RIVQSAEGCI DGKTGGNRFV  240
KLTLTRNSLH LGKQHLPVSF TRNNRLINPG KIILVDKNRA EWPMKLNVDK STRLMYIISG  300
NGWKSFCAAN EIGAGESLTL ELIQGGKIPL LKFVSKMEQP PVEAEARKRK RARVKRWSQE  360
TEPNVEMREK AAEELGEPSR ASHKSSGNPE NLQHTQACSV SNQVAKVKQS VVDALTSVKR  420
FMAELETTEQ KLEISLQEIN NLERGEDNGN KTSSSSKPGE TSVKGQPTSE KQSTLPVLPT  480
EYGPLLAA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1345351ARKRKRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010445032.10.0PREDICTED: B3 domain-containing protein REM8-like
SwissprotQ8H2D10.0REM8_ARATH; B3 domain-containing protein REM8
TrEMBLD7MB410.0D7MB41_ARALL; Putative uncharacterized protein
STRINGscaffold_701042.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.10.0B3 family protein